DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Klk10

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_598473.1 Gene:Klk10 / 69540 MGIID:1916790 Length:278 Species:Mus musculus


Alignment Length:229 Identity:65/229 - (28%)
Similarity:102/229 - (44%) Gaps:32/229 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGS--ALTDSNGTLVDVA 101
            ||||||.:.....|.|.:..:|.::|||||:        .::..:.|.|.  .|......|...:
Mouse    59 PWQVSLFHNLQFQCAGVLVDQNWVLTAAHCW--------RNKPLRARVGDDHLLLFQKEQLRSTS 115

  Fly   102 ALIIHEEY--------AFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSGWGVSY 158
            :.:.|.:|        ....:.:|:.:::||:|:..||.|.|:.|......|.....|||||.| 
Mouse   116 SPVFHPKYQACSGPILPHRSDEHDLMMLKLSSPVMLTSNVHPVQLPFRCSQPGQECQVSGWGTS- 179

  Fly   159 ILNDSTNL-YPTHLQGLALHIKSIFSCRLFDP-----SLLCAGTYG-RTACHGDSGGPLVVNKQL 216
               .|..: |...|....:.:.|...|..|.|     |::||...| :.:|..|||||||.:..|
Mouse   180 ---ASRRVKYNRSLSCSKVTLLSQKQCETFYPGVITNSMICAEADGNQDSCQSDSGGPLVCDDTL 241

  Fly   217 VGVVSWGRKGCVSS---AFFVSVPYFREWILNAI 247
            .||:|||...|.::   :.:..:..:..||...|
Mouse   242 HGVLSWGIYPCGAAQHPSVYSEICKYTPWIRRVI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 62/223 (28%)
Tryp_SPc 27..243 CDD:238113 62/223 (28%)
Klk10NP_598473.1 Tryp_SPc 50..271 CDD:214473 62/223 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.