DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and LOC683849

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_003749780.1 Gene:LOC683849 / 683849 RGDID:1597830 Length:246 Species:Rattus norvegicus


Alignment Length:260 Identity:86/260 - (33%)
Similarity:132/260 - (50%) Gaps:31/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SFLLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCF 69
            |.||:|||...:.......:.:|:||.......||:||||. .|.|.||||:.::..:|:||||:
  Rat     2 SALLILALVGTAVAFPVDDDDKIVGGYTCQENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHCY 65

  Fly    70 FDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFD---LNINDIAIVRLSTPLEFTS 131
            ......||.:....|..|      |...|:.|.:|.|..  ||   || |||.:::||:|::..:
  Rat    66 KSRIQVRLGEHNINVLEG------NEQFVNAAKIIKHPN--FDRKTLN-NDIMLIKLSSPVKLNA 121

  Fly   132 KVQPIPLAKTNPYPRSIALVSGWG--VSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDP----- 189
            :|..:.|..:.....:..|:||||  :|:.:|:     |..||.|...:.....|....|     
  Rat   122 RVATVALPSSCAPAGTQCLISGWGNTLSFGVNE-----PDLLQCLDAPLLPQADCEASYPGKITD 181

  Fly   190 SLLCAGTY--GRTACHGDSGGPLVVNKQLVGVVSWGRKGCV---SSAFFVSVPYFREWILNAIAS 249
            :::|||..  |:.:|.||||||:|.|.:|.|:|||| .||.   :...:..|..:.:||.:.||:
  Rat   182 NMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWG-YGCALPDNPGVYTKVCNYVDWIEDTIAA 245

  Fly   250  249
              Rat   246  245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 76/231 (33%)
Tryp_SPc 27..243 CDD:238113 76/230 (33%)
LOC683849XP_003749780.1 Tryp_SPc 23..239 CDD:214473 76/231 (33%)
Tryp_SPc 24..242 CDD:238113 78/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.