DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and LOC683422

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_006252253.1 Gene:LOC683422 / 683422 RGDID:1586868 Length:312 Species:Rattus norvegicus


Alignment Length:273 Identity:85/273 - (31%)
Similarity:129/273 - (47%) Gaps:47/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLALDFLS--AGQVNRWE---------------QRIIGGEPIGIEQVPWQVSLQYFGDHVCGGS 55
            |||.|.||.  |.....|:               ..|:||:|..|.:|||.|.:...|.|:||||
  Rat    10 LLLPLAFLLSWAHSSQAWKCGQGLSTRPLLQENVSAIMGGKPANISEVPWHVGIMNHGTHLCGGS 74

  Fly    56 IYSENIIVTAAHCFFDEEGNRLDDQGYQVRAG-SALTDSNGTLVDVAALIIHEEYAFDLNINDIA 119
            |.:|..:::|:|||     :::::...::|.| ..|:..|.....|..||:|.::...|..||||
  Rat    75 ILNEWWVLSASHCF-----DQINNANLEIRHGRDDLSTKNVKHEKVDKLILHPKFDDWLLDNDIA 134

  Fly   120 IVRLSTPLEFTSKVQPIPLAKTNPYPRSI---ALVSGWGVSYILNDSTNLYPTHLQGLALHIKSI 181
            ::.|.:||..:  :..||:..:......|   ..|:|||::.:  ....:..|.||.:.:.:...
  Rat   135 LLLLKSPLNLS--INGIPICTSELSDLRIWKNCWVTGWGITNV--SGVKVQTTKLQKVQVDLFRW 195

  Fly   182 FSC----RLFDPSLLCAGT--YGRTACHGDSGGPLVVNKQ-------LVGVVSWGRKGCVSS--- 230
            ..|    .|...::|||||  .|..||.|||||.||.||:       .||:|||| .||...   
  Rat   196 DWCGYVLPLLTKNMLCAGTPDGGMDACQGDSGGALVCNKKRNINTWYQVGIVSWG-VGCGKKNLP 259

  Fly   231 AFFVSVPYFREWI 243
            ..:..|..:.:||
  Rat   260 GVYTKVSPYLKWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 75/236 (32%)
Tryp_SPc 27..243 CDD:238113 75/235 (32%)
LOC683422XP_006252253.1 Tryp_SPc 46..275 CDD:238113 77/237 (32%)
Tryp_SPc 46..272 CDD:214473 75/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.