DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Ctrb1

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_079859.2 Gene:Ctrb1 / 66473 MGIID:88559 Length:263 Species:Mus musculus


Alignment Length:233 Identity:78/233 - (33%)
Similarity:114/233 - (48%) Gaps:24/233 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQ-YFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSA 89
            ||:.||.......||||||| ..|.|.||||:.|||.:||||||     |.:..|..........
Mouse    33 RIVNGEDAIPGSWPWQVSLQDRTGFHFCGGSLISENWVVTAAHC-----GVKTTDVVVAGEFDQG 92

  Fly    90 LTDSNGTLVDVAALIIHEEY-AFDLNINDIAIVRLSTPLEFTSKVQPIPLAKT-NPYPR-SIALV 151
            ..:.|..::.:|.:..:.:: :|.:. |||.:::|:||.:|:..|..:.|... :.:|. ::...
Mouse    93 SDEENVQVLKIAQVFKNPKFNSFTVR-NDITLLKLATPAQFSETVSAVCLPTVDDDFPAGTLCAT 156

  Fly   152 SGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCR-----LFDPSLLCAGTYGRTACHGDSGGPLV 211
            :|||.:......|   |..||..||.|.|...|:     .....::|||..|.::|.||||||||
Mouse   157 TGWGKTKYNALKT---PDKLQQAALPIVSEAKCKESWGSKITDVMICAGASGVSSCMGDSGGPLV 218

  Fly   212 VNKQ----LVGVVSWGRKGCVSS--AFFVSVPYFREWI 243
            ..|.    |.|:||||...|.:|  |.:..|.....|:
Mouse   219 CQKDGVWTLAGIVSWGSGFCSTSTPAVYARVTALMPWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 77/231 (33%)
Tryp_SPc 27..243 CDD:238113 76/230 (33%)
Ctrb1NP_079859.2 Tryp_SPc 33..256 CDD:214473 77/231 (33%)
Tryp_SPc 34..259 CDD:238113 77/232 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.