DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and PRSS56

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001356777.1 Gene:PRSS56 / 646960 HGNCID:39433 Length:604 Species:Homo sapiens


Alignment Length:248 Identity:69/248 - (27%)
Similarity:105/248 - (42%) Gaps:29/248 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQ 80
            |...|.|...||:||........||.|.||..|..:|||.:.:.:.::||||||.......|   
Human    94 STANVTRAHGRIVGGSAAPPGAWPWLVRLQLGGQPLCGGVLVAASWVLTAAHCFVGAPNELL--- 155

  Fly    81 GYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPI--PLAKTNP 143
             :.|.............|.|..::.|.::......||:|:|:|.||:......:|:  |.....|
Human   156 -WTVTLAEGSRGEQAEEVPVNRILPHPKFDPRTFHNDLALVQLWTPVSPGGSARPVCLPQEPQEP 219

  Fly   144 YPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCR------LFDPSLLCAG--TYGRT 200
            ...:...::|||.  :..|...  ...::...:.:.|..:||      |...::||||  ..|..
Human   220 PAGTACAIAGWGA--LFEDGPE--AEAVREARVPLLSTDTCRRALGPGLRPSTMLCAGYLAGGVD 280

  Fly   201 ACHGDSGGPLVVNKQ-------LVGVVSWGRKGC---VSSAFFVSVPYFREWI 243
            :|.|||||||..::.       |.||.||| .||   .....:..|..|::|:
Human   281 SCQGDSGGPLTCSEPGPRPREVLFGVTSWG-DGCGEPGKPGVYTRVAVFKDWL 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 65/236 (28%)
Tryp_SPc 27..243 CDD:238113 64/235 (27%)
PRSS56NP_001356777.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..96 1/1 (100%)
Tryp_SPc 105..335 CDD:238113 65/237 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..475
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 574..604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.