DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and zgc:123217

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:241 Identity:72/241 - (29%)
Similarity:113/241 - (46%) Gaps:29/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGN----RLDDQGYQVRA 86
            ||:||........|||||:.|...|:|||::.....::|||||..:...|    .|   |.|.::
Zfish    36 RIVGGTDAPAGSWPWQVSIHYNNRHICGGTLIHSQWVMTAAHCIINTNINVWTLYL---GRQTQS 97

  Fly    87 GSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNP--YPRSIA 149
             :::.:.|...|.:.::|.|..:...|..|||::::||.|:.|:..::||.||..|.  |..:..
Zfish    98 -TSVANPNEVKVGIQSIIDHPSFNNSLLNNDISLMKLSQPVNFSLYIRPICLAANNSIFYNGTSC 161

  Fly   150 LVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSC---------RLFDPSLLCAGTYGRTACHGD 205
            ..:|||  .|..|.....|..||.:.:.:.:...|         ....|.::|||...:..|.||
Zfish   162 WATGWG--NIGKDQALPAPQTLQQVQIPVVANSLCSTEYESVNNATITPQMICAGKANKGTCQGD 224

  Fly   206 SGGPLVVNKQLV----GVVSWGRK-GCVSSAF---FVSVPYFREWI 243
            ||||....:..|    |:.|:|.. ||...|:   :..|..|:.||
Zfish   225 SGGPFQCKQGSVWIQAGITSYGTSAGCAVGAYPDVYSRVSEFQSWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 70/239 (29%)
Tryp_SPc 27..243 CDD:238113 69/238 (29%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 70/239 (29%)
Tryp_SPc 37..273 CDD:238113 71/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.