DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG17242

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:265 Identity:87/265 - (32%)
Similarity:126/265 - (47%) Gaps:47/265 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIESFLLL-----LALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSEN 60
            |.::..|||     :|.||.|                |||||.|||.|:|....|.|||.||||:
  Fly     1 MLLKGILLLVSIAQIAADFKS----------------IGIEQAPWQASVQINDKHHCGGVIYSED 49

  Fly    61 IIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLST 125
            ||:|.|.|.   ...||  :...||.|||..::.||::.|..:.:.   ...|..:|:||::|.:
  Fly    50 IILTIAECV---RKARL--EFISVRVGSAQENAGGTVLKVEKMRLQ---VLGLRPSDVAILQLRS 106

  Fly   126 PLEFTSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSC------ 184
            ||.....::.||||.....|.:.|.|||||....:|.|:.:    |..:.:.|:....|      
  Fly   107 PLYLDGGIRAIPLATIPLVPGTNASVSGWGQLSAMNPSSEV----LLRVDVKIQDQLMCATNLAL 167

  Fly   185 --RLFDPSLLCAGTYGRT--ACHGDSGGPLVVNKQLVGVVSWGRKGC---VSSAFFVSVPYFREW 242
              ||.....:||...|..  ||.|..|||||.|.:|.|::|| :..|   ..|:.:.::..|:.|
  Fly   168 KGRLMSVGEICAAPAGEIPYACQGFVGGPLVANNRLYGILSW-QSACDVLNKSSVYANIAMFKVW 231

  Fly   243 ILNAI 247
            |.:.:
  Fly   232 IESTV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 77/229 (34%)
Tryp_SPc 27..243 CDD:238113 77/228 (34%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 77/223 (35%)
Tryp_SPc 24..232 CDD:214473 75/220 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.