DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG34290

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001097899.2 Gene:CG34290 / 5740609 FlyBaseID:FBgn0085319 Length:282 Species:Drosophila melanogaster


Alignment Length:266 Identity:64/266 - (24%)
Similarity:102/266 - (38%) Gaps:72/266 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IIGGEPI-----GIEQVPWQVSLQ------------YFGDHVCGGSIYSENIIVTAAHCFFDEEG 74
            |:||..:     ...:.|:.||||            |  .|.||||:.|:..|::||||.:    
  Fly    34 IVGGRIVSTVGSSTSKYPFMVSLQDVITRNTTNGVSY--QHFCGGSLISDRWILSAAHCVW---- 92

  Fly    75 NRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNI-NDIAIVRLSTPL--EFTSKVQ-- 134
             |.:........|....::.|.|.......:...|....|. ||||::.:....  :|.:.:|  
  Fly    93 -RKNIHYIAAFIGYENIENIGQLQPYGLESVEYIYFQPSNFRNDIALLYMKRRYWSDFGNGLQYA 156

  Fly   135 PIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIF----------SCR---- 185
            .:|.....|.......:.|:|.            ||..|...  |.:|          .||    
  Fly   157 QLPPHGMKPDQNESCRIIGYGA------------THHAGPCQ--KRLFEAEVRVIDNQKCRDIIG 207

  Fly   186 -LFDP----SLLCAGTYGRTACHGDSGGPLVV----NKQLVGVVSWGRKGC----VSSAFFVSVP 237
             ::.|    :.:||....:.:|.|||||||:.    ...:.|:||.|.. |    :.|.:.|:.|
  Fly   208 HIWAPQNGANTVCALGNNQDSCQGDSGGPLICTYGGKDYIYGLVSHGLT-CGIPGMPSIYTVTRP 271

  Fly   238 YFREWI 243
            |: :|:
  Fly   272 YY-DWV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 63/264 (24%)
Tryp_SPc 27..243 CDD:238113 63/264 (24%)
CG34290NP_001097899.2 Tryp_SPc 34..277 CDD:238113 64/266 (24%)
Tryp_SPc 34..276 CDD:214473 63/264 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.