DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP011918

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_001689276.1 Gene:AgaP_AGAP011918 / 5667954 VectorBaseID:AGAP011918 Length:259 Species:Anopheles gambiae


Alignment Length:239 Identity:86/239 - (35%)
Similarity:115/239 - (48%) Gaps:32/239 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 WEQRIIGGEPIGIEQVPWQVSL---QYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQV 84
            ||.||:.|......|.|:||||   .|  .|.|||:|...:.|:|||||....:...:      :
Mosquito    28 WEGRIVNGLNAVSGQFPYQVSLTSATY--QHFCGGAIIGNHWILTAAHCLTGRKPAEV------I 84

  Fly    85 RAGSALTDSNGTL-VDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKT-NPYPRS 147
            ....|||.:.|.. .||...|:|..:......||||:||....:.|.:.|.|:.:|:| .|..|:
Mosquito    85 AVVGALTSARGGYNYDVEQFILHPNFNEWTQQNDIALVRTKWSISFNTAVFPVKMARTYTPANRA 149

  Fly   148 IALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSC---------RLFDPSLLCAGTYGRT--- 200
            : |.||||::.:   |.......||.:||...|...|         |...||:||  |:.|.   
Mosquito   150 V-LASGWGLTTL---SVPKPADRLQYVALRTISNEDCSERFRKLQNRAITPSILC--TFSRNEQG 208

  Fly   201 ACHGDSGGPLVVNKQLVGVVSWGRKGCVS-SAFFVSVPYFREWI 243
            .|.||||||||.:.:|||:||||....|. ...:|.|..||.||
Mosquito   209 TCMGDSGGPLVEDGELVGIVSWGIPCAVGYPDVYVRVSSFRAWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 82/234 (35%)
Tryp_SPc 27..243 CDD:238113 81/233 (35%)
AgaP_AGAP011918XP_001689276.1 Tryp_SPc 31..252 CDD:214473 82/234 (35%)
Tryp_SPc 32..252 CDD:238113 81/233 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.