DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP001245

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_001689377.2 Gene:AgaP_AGAP001245 / 5667668 VectorBaseID:AGAP001245 Length:272 Species:Anopheles gambiae


Alignment Length:237 Identity:77/237 - (32%)
Similarity:117/237 - (49%) Gaps:31/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 WEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAG 87
            ::.||.||....|...|:|:||:. ..|.||.|:.|.|..::||||.|......:    ..::.|
Mosquito    45 FQGRIFGGVEADIANYPYQLSLRR-ASHSCGASVISANWALSAAHCTFPVPAPGV----ITLQGG 104

  Fly    88 SALTDSNGTLVDVAALIIHEEYAFDLN-INDIAIVRLSTPLEFTSKVQPIPLAKTNPYPR----- 146
            |:...|.|.:..|..:|.|.:|. |.| :||:.::|.:|||...:    |.:...:|...     
Mosquito   105 SSDRTSGGVVFQVEQIINHPQYD-DWNLVNDVCVLRTTTPLSGVN----IAIIALDPVGATHAVG 164

  Fly   147 SIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRL------FDPSLLCAGTYGRTACHGD 205
            |.|::||||:.     ..::.|..|:.:.:.:....:|..      ..|.::||...||.||:||
Mosquito   165 SRAVLSGWGLM-----EGSVLPAILRRVDIPVVDQGACETAWGSGWVTPDMICASEPGRDACNGD 224

  Fly   206 SGGPLVVNKQLVGVVSWGRKGCVSS--AFF--VSVPYFREWI 243
            |||||||..|.:|:||||...||.:  ..|  |:.|..|.||
Mosquito   225 SGGPLVVGGQQIGIVSWGDTQCVGTRPGVFARVAFPLIRNWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 75/232 (32%)
Tryp_SPc 27..243 CDD:238113 74/231 (32%)
AgaP_AGAP001245XP_001689377.2 Tryp_SPc 48..266 CDD:214473 75/232 (32%)
Tryp_SPc 49..269 CDD:238113 76/233 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.