DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP001247

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_001689376.2 Gene:AgaP_AGAP001247 / 5667666 VectorBaseID:AGAP001247 Length:253 Species:Anopheles gambiae


Alignment Length:249 Identity:80/249 - (32%)
Similarity:118/249 - (47%) Gaps:39/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHC--------FFDEEGNRLDDQGY 82
            ||.||....|:..|.|:||:.|..|:||.|:...::.:|||||        |....|...:...|
Mosquito    16 RIFGGMETNIKDAPHQLSLRRFDSHICGASVVDASLAITAAHCLTPKPPPEFITLMGGSTNRTDY 80

  Fly    83 QVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPL-------AK 140
            .|          |.:.:...||||..|..:...||:|:||:.........|.||||       :.
Mosquito    81 DV----------GVIFNAIELIIHPGYNSNTFHNDVALVRIEGTFGGYENVAPIPLRTRTIFTSS 135

  Fly   141 TNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSC-RLFDP-----SLLCAGTYGR 199
            :||.   ...|||||::.:..|.   .|..|:.:.:.:.....| |.::|     |::|||...:
Mosquito   136 SNPV---YCTVSGWGLTNMNGDG---LPEILRIVRIPLVPYTECRRKWNPFPITSSMICAGELRK 194

  Fly   200 TACHGDSGGPLVVNKQLVGVVSWGRKGCVSS--AFFVSVPYFREWILNAIASIQ 251
            .||:||||||||.|.||.|:||||...|.||  ..:.|:|....::...::.:|
Mosquito   195 DACNGDSGGPLVCNGQLYGIVSWGSNQCGSSYPGIYTSIPAVLSFLSEYMSPMQ 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 79/239 (33%)
Tryp_SPc 27..243 CDD:238113 78/238 (33%)
AgaP_AGAP001247XP_001689376.2 Tryp_SPc 16..238 CDD:214473 79/237 (33%)
Tryp_SPc 17..242 CDD:238113 78/240 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.