DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP001251

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_001689373.2 Gene:AgaP_AGAP001251 / 5667665 VectorBaseID:AGAP001251 Length:290 Species:Anopheles gambiae


Alignment Length:230 Identity:81/230 - (35%)
Similarity:115/230 - (50%) Gaps:43/230 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALT 91
            |.|||.:.||..|:|:||:..|.|:||.|:.:|...::||||        ||:..|.    ||:|
Mosquito    64 IFGGESVAIESYPYQLSLRLEGTHICGASVIAERWALSAAHC--------LDEALYP----SAIT 116

  Fly    92 DSNGTLVDVA-ALIIHEEY-----AFDLNI--NDIAIVRLSTPLEFTSKVQPIPLAKTN---PYP 145
            ...||...:| ..|.|.||     .||...  .|:::..:.... |...::.:.||.||   |.|
Mosquito   117 FRGGTPHRLAGGYIFHAEYYLLHPKFDRRTLDYDVSVTHVRESF-FIDPIRAVTLANTNTYYPIP 180

  Fly   146 RSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSC------RLFDPSLLC--AGTYGRTAC 202
             |.|:|:|||    |.|:....|..||.|.::::....|      .|.|.. :|  :|.||:..|
Mosquito   181 -SAAVVTGWG----LADADGYEPLILQSLEIYLQQKQFCWTSTIEALTDRQ-ICGGSGVYGKETC 239

  Fly   203 HGDSGGPLVVNKQLVGVVSWGRKGCVSSAFFVSVP 237
            :||||||||:|...||:||||...|.     |::|
Mosquito   240 YGDSGGPLVMNGYQVGIVSWGSDNCA-----VNIP 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 81/230 (35%)
Tryp_SPc 27..243 CDD:238113 81/230 (35%)
AgaP_AGAP001251XP_001689373.2 Tryp_SPc 64..277 CDD:214473 81/230 (35%)
Tryp_SPc 64..277 CDD:238113 81/230 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.