DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP006485

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_001688885.1 Gene:AgaP_AGAP006485 / 5667297 VectorBaseID:AGAP006485 Length:281 Species:Anopheles gambiae


Alignment Length:271 Identity:75/271 - (27%)
Similarity:118/271 - (43%) Gaps:45/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SFLLLL--ALDFLSAGQVNRWEQ--RIIGGEPIGIEQVPWQVSLQ-YFGDHVCGGSIYSENIIVT 64
            :|:|.|  ||..:....|...::  |:|||......|.|..||:. .|..| |||::.....::|
Mosquito     5 AFVLCLAVALPCIRGDNVESEDRSPRLIGGTNAPWGQFPSAVSINTTFNVH-CGGAVVDRQHVLT 68

  Fly    65 AAHCFFDEEGNRLDDQGYQVRAGS---ALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTP 126
            ||.|.|:.....:|.....||||.   |...:......|:.:.:|.::......:|:|::||..|
Mosquito    69 AAQCVFNANLRLVDPYWITVRAGDIALAPVGARRQTRKVSHIFVHPQFNIRTLEHDVAVLRLDRP 133

  Fly   127 LEFTSKVQPIPLAKTNPYPRSIALV--------SGWGVS-YILNDSTNLYPTHLQG-LALHIKSI 181
            .:..|..  |.||.     |:..:|        :|||.| ..||...|:    ||. |.:.:...
Mosquito   134 YDLPSNT--INLAN-----RTRRIVPNGASCQFAGWGASTAALNAPVNV----LQRFLPMTVNDR 187

  Fly   182 FSC--------RLFDPSLLCAGTYG----RTACHGDSGGPLVVNKQLVGVVSWGRK-GCVSS-AF 232
            ..|        |:.: |.||||..|    ...|:|::|..|...:.|||.:|:|.. |..:: ..
Mosquito   188 DMCNQANMHAGRMLE-SHLCAGNTGGSNNAAPCNGNAGTGLYCERALVGTLSFGLNCGAANNPPV 251

  Fly   233 FVSVPYFREWI 243
            |..|.::.:||
Mosquito   252 FTQVRFYNDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 67/244 (27%)
Tryp_SPc 27..243 CDD:238113 66/243 (27%)
AgaP_AGAP006485XP_001688885.1 Tryp_SPc 30..262 CDD:214473 67/244 (27%)
Tryp_SPc 32..265 CDD:238113 68/244 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.