DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Klk11

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001170844.1 Gene:Klk11 / 56538 MGIID:1929977 Length:276 Species:Mus musculus


Alignment Length:263 Identity:81/263 - (30%)
Similarity:115/263 - (43%) Gaps:49/263 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHC--- 68
            |.|:|| .|..|.|. .|.|||.|........||||:|......:||.::.:...::|||||   
Mouse    30 LRLIAL-ALVTGHVG-GETRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTAAHCRKP 92

  Fly    69 ---FFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDL----NINDIAIVRLSTP 126
               ....|.|.....|.:.|  ...|:|          ..|.::...|    :.|||.:|::|:|
Mouse    93 HYVILLGEHNLEKTDGCEQR--RMATES----------FPHPDFNNSLPNKDHRNDIMLVKMSSP 145

  Fly   127 LEFTSKVQPIPLAKTNPYPRSIA-----LVSGWGVSYILNDSTNL-YPTHLQGLALHIKSIFSCR 185
            :.||..|||:.|:     |..:|     |:||||.:    .|..| .|..|:...:.|.....|.
Mouse   146 VFFTRAVQPLTLS-----PHCVAAGTSCLISGWGTT----SSPQLRLPHSLRCANVSIIEHKECE 201

  Fly   186 LFDP-----SLLCAGT--YGRTACHGDSGGPLVVNKQLVGVVSWGRKGCV---SSAFFVSVPYFR 240
            ...|     ::|||..  .|:.:|.||||||||.|..|.|::|||:..|.   ....:..|..:.
Mouse   202 KAYPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCKYF 266

  Fly   241 EWI 243
            .||
Mouse   267 NWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 71/242 (29%)
Tryp_SPc 27..243 CDD:238113 70/241 (29%)
Klk11NP_001170844.1 Tryp_SPc 47..269 CDD:214473 71/242 (29%)
Tryp_SPc 48..272 CDD:238113 72/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.