DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and si:dkey-33m11.8

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_693464.3 Gene:si:dkey-33m11.8 / 565078 ZFINID:ZDB-GENE-141215-49 Length:251 Species:Danio rerio


Alignment Length:266 Identity:74/266 - (27%)
Similarity:134/266 - (50%) Gaps:51/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFF 70
            :.|||.:..|...:    :||||||:.:....:.:|.|:||...|.|||::.....:|:||||: 
Zfish     7 YTLLLIVSMLQGSK----QQRIIGGQEVQPYSIKYQASVQYNNYHYCGGTLIHPQWVVSAAHCW- 66

  Fly    71 DEEGNRLDDQGYQVRAGSALTDSNGTLVD-------VAALIIHEEYAFDLNINDIAIVRLSTPLE 128
                    ...|.::.  .|::.:.:.::       |:..::|..|.:....:||.:::|..|.|
Zfish    67 --------RPSYLIKV--VLSEHDLSKIEGFERVFNVSKALVHYMYNYRTFDSDIMLLKLEKPAE 121

  Fly   129 FTSKVQPIPLAKTNPYPR--SIALVSGWGVSYILNDSTNLYPTHLQGL--ALHIKSIFSCRLF-- 187
            .::.:||..|..:.|..:  ::.:||||||       |.:|..:|..:  |:.::.|..|:.:  
Zfish   122 LSATIQPAVLPVSVPALQGGTVCIVSGWGV-------TQVYSYYLSPVLRAVDVQIIPQCQYYYY 179

  Fly   188 ---DPSLLCAGT--YGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAFFVSV--------PYF 239
               ..:::|||:  .|:.:|.|||||||:.|....|:|||| ..| ::|:|..|        |:.
Zfish   180 YRITDNMVCAGSPLGGKDSCQGDSGGPLICNGYFEGIVSWG-ISC-ANAYFPGVYTKVRNYIPWM 242

  Fly   240 REWILN 245
             .||::
Zfish   243 -TWIID 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 67/242 (28%)
Tryp_SPc 27..243 CDD:238113 66/241 (27%)
si:dkey-33m11.8XP_693464.3 Tryp_SPc 23..241 CDD:214473 66/237 (28%)
Tryp_SPc 24..241 CDD:238113 65/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.