DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and MASP1

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_011511291.1 Gene:MASP1 / 5648 HGNCID:6901 Length:735 Species:Homo sapiens


Alignment Length:271 Identity:72/271 - (26%)
Similarity:117/271 - (43%) Gaps:59/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QRIIGG---EPIGIEQVPWQVSL-----------QYFGDHVCGGSIYSENIIVTAAHCFFDEEGN 75
            :|||||   || |:  .|||..:           ::||    .|::.|.:.|:||||....:..:
Human   455 KRIIGGRNAEP-GL--FPWQALIVVEDTSRVPNDKWFG----SGALLSASWILTAAHVLRSQRRD 512

  Fly    76 R----LDDQGYQVRAG-SALTDSNGTLVDVAA-LIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQ 134
            .    :..:...|..| ..:.|.:|.:...|| :::|.::......:|||:|:|..|:.....|.
Human   513 TTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVVLHPDFNIQNYNHDIALVQLQEPVPLGPHVM 577

  Fly   135 PIPLAK---TNPYPRSIALVSGWGVS-------YILNDSTNLYPTHLQGLALHIKSIFSCRL--- 186
            |:.|.:   ..|.|..:.||:|||:|       .|::..|......||.:.|.:.....|:.   
Human   578 PVCLPRLEPEGPAPHMLGLVAGWGISNPNVTVDEIISSGTRTLSDVLQYVKLPVVPHAECKTSYE 642

  Fly   187 -------FDPSLLCAGTY--GRTACHGDSGGPLVVNKQL------VGVVSW-GRKGCVSS---AF 232
                   ...::.|||.|  |:..|.|||||..|:...|      .|:||| |.:.|.|.   ..
Human   643 SRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDDLSQRWVVQGLVSWGGPEECGSKQVYGV 707

  Fly   233 FVSVPYFREWI 243
            :..|..:.:|:
Human   708 YTKVSNYVDWV 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 71/268 (26%)
Tryp_SPc 27..243 CDD:238113 70/267 (26%)
MASP1XP_011511291.1 CUB 35..144 CDD:238001
FXa_inhibition 160..188 CDD:291342
CUB 192..301 CDD:278839
Sushi 308..369 CDD:278512
CCP 374..439 CDD:153056
Tryp_SPc 456..718 CDD:214473 71/268 (26%)
Tryp_SPc 457..718 CDD:238113 70/267 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.