DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and PRSS3

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:236 Identity:80/236 - (33%)
Similarity:117/236 - (49%) Gaps:21/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGS 88
            :.:|:||.......:|:||||. .|.|.||||:.||..:|:||||:......||.:...:|..| 
Human   107 DDKIVGGYTCEENSLPYQVSLN-SGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEG- 169

  Fly    89 ALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSG 153
                 |...::.|.:|.|.:|..|...|||.:::||:|....::|..|.|..|.|...:..|:||
Human   170 -----NEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISG 229

  Fly   154 WGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDP-----SLLCAGTY--GRTACHGDSGGPLV 211
            ||.:......   ||..|:.|...:.:...|:...|     |:.|.|..  |:.:|..|||||:|
Human   230 WGNTLSFGAD---YPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVV 291

  Fly   212 VNKQLVGVVSWGRKGCV---SSAFFVSVPYFREWILNAIAS 249
            .|.||.||||||. ||.   ....:..|..:.:||.:.||:
Human   292 CNGQLQGVVSWGH-GCAWKNRPGVYTKVYNYVDWIKDTIAA 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 76/226 (34%)
Tryp_SPc 27..243 CDD:238113 76/225 (34%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 76/226 (34%)
Tryp_SPc 110..328 CDD:238113 78/228 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.