DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and PROC

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_024308770.1 Gene:PROC / 5624 HGNCID:9451 Length:576 Species:Homo sapiens


Alignment Length:266 Identity:72/266 - (27%)
Similarity:110/266 - (41%) Gaps:65/266 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDH----VCGGSIYSENIIVTAAHCFFDEEGNRLDD 79
            |.::.:.|:|.|:.......||||.|.   |.    .||..:...:.::||||| .||....|..
Human   319 QEDQVDPRLIDGKMTRRGDSPWQVVLL---DSKKKLACGAVLIHPSWVLTAAHC-MDESKKLLVR 379

  Fly    80 QG-YQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNP 143
            .| |.:|........    :|:..:.:|..|:.....||||::.|:.|...:..:.||.|..:..
Human   380 LGEYDLRRWEKWELD----LDIKEVFVHPNYSKSTTDNDIALLHLAQPATLSQTIVPICLPDSGL 440

  Fly   144 YPRSI------ALVSGWGV------------SYILNDSTNLYPTHLQGLALHIK---------SI 181
            ..|.:      .||:|||.            :::||               .||         |.
Human   441 AERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLN---------------FIKIPVVPHNECSE 490

  Fly   182 FSCRLFDPSLLCAGTYG--RTACHGDSGGPLVVNKQ----LVGVVSWGRKGC---VSSAFFVSVP 237
            ....:...::||||..|  :.||.||||||:|.:..    |||:|||| :||   .:...:..|.
Human   491 VMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLVSWG-EGCGLLHNYGVYTKVS 554

  Fly   238 YFREWI 243
            .:.:||
Human   555 RYLDWI 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 69/257 (27%)
Tryp_SPc 27..243 CDD:238113 68/256 (27%)
PROCXP_024308770.1 GLA 117..168 CDD:214503
EGF_CA 182..213 CDD:238011
FXa_inhibition 255..290 CDD:317114
Tryp_SPc 328..563 CDD:238113 70/257 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.