DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:264 Identity:83/264 - (31%)
Similarity:122/264 - (46%) Gaps:48/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYF-------GDHVCGGSIYSENIIVT 64
            ||.:.|:.|:....:..:.||:||      .||...|::|.       |.|.|||::.::..::|
Zfish     7 LLCVLLEILAVSCQDVIQARIVGG------YVPAPYSIKYIVSIQSATGQHFCGGTLINKYWVLT 65

  Fly    65 AAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEF 129
            ||||...|...|:....|.|    .|.:..........||.|.:|....|..||.:::|.:|:..
Zfish    66 AAHCNIGEANMRIVAGDYSV----GLYEGMEQFRRPHMLIPHPQYDRSTNNADIMLIKLQSPVYL 126

  Fly   130 TSKVQPIPLAKTNPYPRSIAL--------VSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRL 186
            .|.|..:||      ||..|:        |||||    ...||....:.|:.:.|.|.|...|..
Zfish   127 NSYVSLVPL------PRQDAMVAVGRLCSVSGWG----FTTSTGGISSILRTVKLPIVSTAVCNG 181

  Fly   187 FD-------PSLLCAG--TYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYF 239
            .|       .:::|||  |.|:.||.||||||||...::.|:|||| .||..:.:   :.:|..|
Zfish   182 TDSFNGNITENMICAGYSTGGKDACKGDSGGPLVCEGRVYGIVSWG-NGCADAQYPGVYTAVSQF 245

  Fly   240 REWI 243
            |:||
Zfish   246 RQWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 77/243 (32%)
Tryp_SPc 27..243 CDD:238113 76/242 (31%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 77/243 (32%)
Tryp_SPc 27..252 CDD:238113 78/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.