DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and LOC560023

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_021325702.1 Gene:LOC560023 / 560023 -ID:- Length:271 Species:Danio rerio


Alignment Length:247 Identity:78/247 - (31%)
Similarity:120/247 - (48%) Gaps:49/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 WEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFD--------EEGNRLDD 79
            :.||||||:.:....:.:|||||....|.|||::.....::|||||:..        .|.|...:
Zfish    40 FSQRIIGGQEVVPYSIKYQVSLQVDRKHFCGGTLIQPQWVLTAAHCWRPASVIQVVLSEHNLAVE 104

  Fly    80 QGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQP--IPLAKTN 142
            :|::            .:..||.:..|..|......|||.|::|:.|.:..:.|||  :|.|.| 
Zfish   105 EGFE------------QVCTVAKVFSHVAYNPKTFNNDIMIIKLTAPAQINAYVQPALLPTADT- 156

  Fly   143 PYPR----SIALVSGWGVSYILNDSTNLYPTHLQGL--ALHIKSIFSCRLF-----DPSLLCAGT 196
              |.    |...||||||       |.||..:|..:  |:.::...||:|:     :.:::|||:
Zfish   157 --PELAGGSSCTVSGWGV-------TRLYNFYLSPILRAVDVEIFSSCQLYYYYRVNDNMICAGS 212

  Fly   197 Y--GRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWI 243
            .  |:.:|.|||||||:.:..|.|:|||| .||....:   :..|..:..||
Zfish   213 RFGGKDSCQGDSGGPLICDGYLEGIVSWG-IGCALPYYPGVYTKVRNYNRWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 75/242 (31%)
Tryp_SPc 27..243 CDD:238113 74/241 (31%)
LOC560023XP_021325702.1 Tryp_SPc 43..263 CDD:214473 75/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.