DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and si:dkey-21e2.10

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_009294620.1 Gene:si:dkey-21e2.10 / 556860 ZFINID:ZDB-GENE-050208-778 Length:249 Species:Danio rerio


Alignment Length:224 Identity:60/224 - (26%)
Similarity:105/224 - (46%) Gaps:22/224 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAAL 103
            |:.||||::..|:||||:.:|..::|||||:.:::...:....:.:|..:.     ..:..|.:.
Zfish    36 PYMVSLQFYKLHMCGGSLITEEFVLTAAHCWEEDDVLTVVTGAHDLRKKAI-----NNVYKVKSY 95

  Fly   104 IIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIAL--VSGWGVSYILNDSTNL 166
            |.|.::......|||.:::|.|.:..::.|..|.|.|.....::..|  |:|||..:.....|: 
Zfish    96 IPHPDFNSKTLENDIMLLQLKTKVRLSNNVGLISLPKDGEDVKADTLCSVAGWGDLWSKGPETD- 159

  Fly   167 YPTHLQGLALHIKSIFSC-RLFD-----PSLLCAGTYGRTACHGDSGGPLVVNKQLVGVVSWGRK 225
               .|:.....|.:...| |.::     ..::|...:|.| |.||||||||....:||:.|:|..
Zfish   160 ---RLREAETVIVNNAECERRWESDYVASKMICVYGHGGT-CSGDSGGPLVCGDTVVGITSFGEP 220

  Fly   226 GCVSSAFF----VSVPYFREWILNAIASI 250
            ...:|..|    ..:..:..||.|....:
Zfish   221 YLCNSRLFPDVHTRISAYLPWIHNITGKV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 57/215 (27%)
Tryp_SPc 27..243 CDD:238113 57/215 (27%)
si:dkey-21e2.10XP_009294620.1 Tryp_SPc 27..242 CDD:214473 57/215 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.