DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and KLK15

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:255 Identity:83/255 - (32%)
Similarity:115/255 - (45%) Gaps:27/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDE 72
            |||.|.||.|....:...:::.|:.......||||:|...|...||.|:.|.:.:::||||....
Human     3 LLLTLSFLLASTAAQDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHCQSRF 67

  Fly    73 EGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIP 137
            ...||.:...:.|      |....|...:.:|.|..|....:.|||.::||..|.....:|:|..
Human    68 MRVRLGEHNLRKR------DGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLNPQVRPAV 126

  Fly   138 LAKTNPYPRSIALVSGWG-VSYILND--------STNLYPTHLQGLALHIKSIFSCRLFDP---- 189
            |....|:|....:||||| ||:  |:        |....|..|....:.|.|..||....|    
Human   127 LPTRCPHPGEACVVSGWGLVSH--NEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKSYPGRLT 189

  Fly   190 -SLLCAGTYGRTA--CHGDSGGPLVVNKQLVGVVSWGRKGC---VSSAFFVSVPYFREWI 243
             :::|||..||.|  |.||||||||....|.|:||||...|   .....:..|.::.|||
Human   190 NTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYTKVCHYLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 74/235 (31%)
Tryp_SPc 27..243 CDD:238113 74/234 (32%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 74/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.