DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Cfd

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001071110.1 Gene:Cfd / 54249 RGDID:2498 Length:263 Species:Rattus norvegicus


Alignment Length:266 Identity:78/266 - (29%)
Similarity:122/266 - (45%) Gaps:32/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IESFLLLLALDFLSAGQ-VNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAA 66
            :.|.:.|:||..|.|.. |.:...||:||:.......|:..|:|..|.|||||::..|..:::||
  Rat     1 MHSSVYLVALVVLEAAVCVAQPRGRILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAA 65

  Fly    67 HCFFDEEGNRLD----DQGYQVRAGSALTDSNGT---LVDVAALIIHEEYAFDLNINDIAIVRLS 124
            ||        :|    |:..||..|:....|...   |.||.::::|.....|...:|:.:.:||
  Rat    66 HC--------MDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLS 122

  Fly   125 TPLEFTSKVQPIPLAKTN--PYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRL- 186
            ........|:|:||.:.:  ..|.::..|:||||.    ......|..||.|.:.|....:|.| 
  Rat   123 HNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVV----THAGRRPDVLQQLTVSIMDRNTCNLR 183

  Fly   187 ------FDPSLLCAGTYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVS---SAFFVSVPYFREW 242
                  ...:::||.:..|..|.||||||||....:..||:||.:.|.:   ...|..|..:..|
  Rat   184 TYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPW 248

  Fly   243 ILNAIA 248
            |.|.::
  Rat   249 IENVLS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 68/235 (29%)
Tryp_SPc 27..243 CDD:238113 67/234 (29%)
CfdNP_001071110.1 Tryp_SPc 26..252 CDD:238113 69/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.