DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CELA2B

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_056933.3 Gene:CELA2B / 51032 HGNCID:29995 Length:269 Species:Homo sapiens


Alignment Length:263 Identity:81/263 - (30%)
Similarity:120/263 - (45%) Gaps:61/263 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGD----HVCGGSIYSENIIVTAAHCFFDEEGNRLDDQG-YQVR 85
            |::|||.......||||||||..:    |.||||:.:.:.::|||||        :...| |:|.
Human    28 RMLGGEEARPNSWPWQVSLQYSSNGQWYHTCGGSLIANSWVLTAAHC--------ISSSGIYRVM 84

  Fly    86 AGS---ALTDSNGTLVDVAALIIHEEYAFD--LNINDIAIVRLSTPLEFTSKVQ--PIPLAKT-- 141
            .|.   .:.:|....|.|:.:::|:::..|  ...||||:::|:.|:..|.|:|  .:|.|.|  
Human    85 LGQHNLYVAESGSLAVSVSKIVVHKDWNSDQVSKGNDIALLKLANPVSLTDKIQLACLPPAGTIL 149

  Fly   142 -NPYPRSIALVSGWGVSYILNDSTN-LYPTHLQGLALHIKSIFSC-------RLFDPSLLCAGTY 197
             |.||   ..|:|||     ...|| ..|..|:...|.:....:|       .....:::|||..
Human   150 PNNYP---CYVTGWG-----RLQTNGALPDDLKQGQLLVVDYATCSSSGWWGSTVKTNMICAGGD 206

  Fly   198 G-RTACHGDSGGPLVVNKQLVGVVSWGR------------KGC---VSSAFFVSVPYFREWILNA 246
            | ...|:|||||||  |.|    .|.||            .||   ...:.|..|..:.:||.:.
Human   207 GVICTCNGDSGGPL--NCQ----ASDGRWEVHGIGSLTSVLGCNYYYKPSIFTRVSNYNDWINSV 265

  Fly   247 IAS 249
            ||:
Human   266 IAN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 77/255 (30%)
Tryp_SPc 27..243 CDD:238113 76/254 (30%)
CELA2BNP_056933.3 Tryp_SPc 31..265 CDD:238113 78/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.