DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Elane

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:253 Identity:80/253 - (31%)
Similarity:114/253 - (45%) Gaps:29/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDE 72
            :|||| ||....:   ...|:||.|......|:..|||..|.|.||.::.:.|.:::||||.   
Mouse    14 MLLAL-FLGGPAL---ASEIVGGRPARPHAWPFMASLQRRGGHFCGATLIARNFVMSAAHCV--- 71

  Fly    73 EGNRLDDQGYQVRAGS-ALTDSNGTLVDVAALIIHEEYAFDLN--INDIAIVRLSTPLEFTSKVQ 134
              |.|:.:..||..|: .|.....|....:...|.|. .||.:  :|||.|::|:......:.||
Mouse    72 --NGLNFRSVQVVLGAHDLRRQERTRQTFSVQRIFEN-GFDPSQLLNDIVIIQLNGSATINANVQ 133

  Fly   135 --PIPLAKTNPYPRSIALVSGWGVSYILNDSTNL-YPTHLQGLALHIKSIFSCRLFDPSLLCAGT 196
              .:|........|:..|..|||     ...||. .|:.||.|.:.:.:....|..:   :|...
Mouse   134 VAQLPAQGQGVGDRTPCLAMGWG-----RLGTNRPSPSVLQELNVTVVTNMCRRRVN---VCTLV 190

  Fly   197 YGRTA--CHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWILNAIAS 249
            ..|.|  |.||||||||.|..:.|:.|:.|.||.|..:   |..|..|.:||.:.|.|
Mouse   191 PRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGLYPDAFAPVAEFADWINSIIRS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 70/227 (31%)
Tryp_SPc 27..243 CDD:238113 70/226 (31%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 70/227 (31%)
Tryp_SPc 29..245 CDD:238113 72/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.