Sequence 1: | NP_722785.1 | Gene: | CG17234 / 59225 | FlyBaseID: | FBgn0042187 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006230384.1 | Gene: | Prss53 / 499270 | RGDID: | 1566127 | Length: | 591 | Species: | Rattus norvegicus |
Alignment Length: | 244 | Identity: | 61/244 - (25%) |
---|---|---|---|
Similarity: | 99/244 - (40%) | Gaps: | 68/244 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 PWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDS---NGTLVDV 100
Fly 101 AALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTN 165
Fly 166 LY-PTH------------------------------------LQGLALHIKSIFSCR-------- 185
Fly 186 --LFDPS---LLCAGTYG--RTACHGDSGGPLVVNKQ-----LVGVVSW 222 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17234 | NP_722785.1 | Tryp_SPc | 26..243 | CDD:214473 | 61/244 (25%) |
Tryp_SPc | 27..243 | CDD:238113 | 61/244 (25%) | ||
Prss53 | XP_006230384.1 | Tryp_SPc | 45..310 | CDD:238113 | 61/244 (25%) |
Tryp_SPc | 341..561 | CDD:238113 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166343312 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24276 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |