DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Prss36

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:254 Identity:77/254 - (30%)
Similarity:117/254 - (46%) Gaps:49/254 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSAL 90
            ||:||........||||||.:.|.|:||||:.:.:.:::|||||. ..|.......:.|..|...
  Rat    58 RIVGGSDAHPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCFV-TNGTLEPADEWSVLLGVHS 121

  Fly    91 TD---SNGTLVDVAALIIHEEYA-FDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIAL- 150
            .|   ....:..||.:::.:.|: .:|.. |:|::||::|.:....|:|:.|      ||:..| 
  Rat   122 QDGPLEGAHMRSVATILVPDNYSRVELGA-DLALLRLASPAKLGPSVKPVCL------PRASHLF 179

  Fly   151 -------VSGWGVSYILNDSTNL-YPTHLQGLALHIKSIFSCR-LFD------------PSLLCA 194
                   .:|||   .:.:|..| .|..||.:.|.:....:|: |:.            |.:|||
  Rat   180 AHGTACWATGWG---DVQESDPLPVPWVLQEVELKLLGETACQCLYSRPGPFNLTLQLLPGMLCA 241

  Fly   195 GTY---GRTACHGDSGGPLVVNKQ----LVGVVSWGRKGC---VSSAFFVSVPYFREWI 243
            | |   .|..|.||||||||....    |.|:.|:| .||   .....|.:|.::..||
  Rat   242 G-YPEGRRDTCQGDSGGPLVCEDGGRWFLAGITSFG-FGCGRRNRPGVFTAVAHYESWI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 75/252 (30%)
Tryp_SPc 27..243 CDD:238113 74/251 (29%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 76/253 (30%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343284
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.