DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and cela1.2

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001011493.1 Gene:cela1.2 / 496993 XenbaseID:XB-GENE-5739190 Length:265 Species:Xenopus tropicalis


Alignment Length:283 Identity:86/283 - (30%)
Similarity:123/283 - (43%) Gaps:63/283 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQVN------RWEQRIIGGEPIGIEQVPWQVSLQYFGD----HVCGGSIYSENI 61
            ||:||. |:..||.:      ...:|:|||..:.....||||||||...    |.||||:...|.
 Frog     4 LLVLAA-FVLCGQCSNDIRLIEDHERVIGGTEVQRNSWPWQVSLQYLSGGSWYHTCGGSLIRANR 67

  Fly    62 IVTAAHCFFDEEGNRL---DDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNIN------D 117
            ::|||||.......|:   |...||       .|.....:.|:.::.|..:    |.|      |
 Frog    68 VLTAAHCVDRAVSYRVVVGDHNIYQ-------NDGTEQYISVSRIVKHANW----NPNNIAAGYD 121

  Fly   118 IAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIAL-------VSGWGVSYILNDSTNLYPTHLQGLA 175
            |:|:.||:.....|.|:...|...|     :.|       |:|||.:   :::.|| .:.||...
 Frog   122 ISILHLSSSATLNSYVKLAQLPADN-----VVLAHNYNCVVTGWGKT---SNNGNL-ASVLQQAP 177

  Fly   176 LHIKSIFSC-------RLFDPSLLCAGTYG-RTACHGDSGGPL--VVN--KQLVGVVSW-GRKGC 227
            |.:.:..:|       .....:::|||..| |:.|.|||||||  .||  .|:.||.|: ...||
 Frog   178 LPVIAHSTCSSGSYWGSTVKSTMVCAGGDGVRSGCQGDSGGPLNCPVNGVYQVHGVTSFVSSSGC 242

  Fly   228 ---VSSAFFVSVPYFREWILNAI 247
               :....|..|..:..||.|.|
 Frog   243 STYLKPTVFTRVSAYIGWINNNI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 75/252 (30%)
Tryp_SPc 27..243 CDD:238113 74/251 (29%)
cela1.2NP_001011493.1 Tryp_SPc 29..264 CDD:238113 76/254 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.