DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and alphaTry

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster


Alignment Length:244 Identity:99/244 - (40%)
Similarity:133/244 - (54%) Gaps:20/244 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGY 82
            |.:.:.:.||:||....|...|||:|||..|.|.|||||||.|||||||||......:.|     
  Fly    22 GLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVL----- 81

  Fly    83 QVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRS 147
            ||||||....|.|.:..|::...||.|..:..:||||::|||:.|.|:|.::.|.||..||...:
  Fly    82 QVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPANGA 146

  Fly   148 IALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSC--------RLFDPSLLCAGTYGRTACHG 204
            .|.|||||..   :..::..|:.||.:.::|.|...|        .....:::||...|:.||.|
  Fly   147 SAAVSGWGTQ---SSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAAASGKDACQG 208

  Fly   205 DSGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWILNAIASI 250
            |||||||....|||||||| .||..|.:   :..|...|.|:::...||
  Fly   209 DSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAVLRSWVVSTANSI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 95/227 (42%)
Tryp_SPc 27..243 CDD:238113 94/226 (42%)
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 95/227 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443187
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.