DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP010240

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_001238153.2 Gene:AgaP_AGAP010240 / 4578338 VectorBaseID:AGAP010240 Length:275 Species:Anopheles gambiae


Alignment Length:247 Identity:78/247 - (31%)
Similarity:117/247 - (47%) Gaps:49/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSAL 90
            ||:.|.|..:.|.|:||.|...|...||||:.|...::|||||       ::....:.|||||..
Mosquito    43 RIVNGFPASLGQFPYQVFLIGDGSLACGGSLISAEWVLTAAHC-------QVGISQFTVRAGSIQ 100

  Fly    91 TDSNGTLVDVAALIIHEEY-AFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTN---PYPRSIALV 151
            .:|.||:.....:|||..| ..:|| |||.::||:.|:.....:|.:.|.:.|   .:....|.|
Mosquito   101 NNSGGTVRTSNLIIIHPNYNPSNLN-NDIGLIRLNEPMPLGGNIQVVALPEANLSETFLNREATV 164

  Fly   152 SGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDPSLLCAGTYG------------------ 198
            ||:|.:   :|::.....:|..:.|:|.|         ::.|.||||                  
Mosquito   165 SGFGRT---SDASGAISPNLNFVHLNIIS---------NIQCMGTYGSATIIDSTVCAVGRDAPN 217

  Fly   199 RTACHGDSGGPLVVNKQ----LVGVVSW-GRKGCVSS--AFFVSVPYFREWI 243
            :..|:|||||||.|.:.    .:||||: ...||...  :.:|...:||.||
Mosquito   218 QGTCNGDSGGPLTVTENGQSVQIGVVSFVAAAGCEVGFPSGYVRTTHFRNWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 76/245 (31%)
Tryp_SPc 27..243 CDD:238113 75/244 (31%)
AgaP_AGAP010240XP_001238153.2 Tryp_SPc 43..269 CDD:214473 76/245 (31%)
Tryp_SPc 44..272 CDD:238113 77/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.