DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP009216

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_001238238.1 Gene:AgaP_AGAP009216 / 4578289 VectorBaseID:AGAP009216 Length:244 Species:Anopheles gambiae


Alignment Length:238 Identity:66/238 - (27%)
Similarity:99/238 - (41%) Gaps:41/238 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QVPWQVSLQ-YFGDHVCGGSIYSENIIVTAAHC-------FFDEEGNRLDDQGYQVRAGSALTDS 93
            |:||...|: ..|:..|..|:.||..::|.|||       |........|:||....|...    
Mosquito    15 QLPWTALLKTSSGEFACAASLISERYVLTVAHCIKNRNVTFVQLRKKDCDEQGVCTLAPQD---- 75

  Fly    94 NGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPI--PLAKTNPYPRSIALVSGWGV 156
                :.|...|.|:.::....:||||:|||:..:.|.:.|.||  |:|.......|....:..|.
Mosquito    76 ----IPVERAIAHDGFSARRKLNDIALVRLAQNVSFNNDVLPICLPVAPEYQPAGSNYFTARDGQ 136

  Fly   157 SYI-LNDS----TNLYPTHLQGLALHIKSIFSCR-LFDPSLLC---AGTYGRTACHGDSGGPLVV 212
            .|. ||..    |.::|...:.....::.:...: ....|.:|   ||::  ..|...:|||||.
Mosquito   137 DYASLNTDTISITEVHPLTTENCENRLQELIKRQHKIQESHICGYEAGSF--DGCATSAGGPLVA 199

  Fly   213 ------NKQLVGVVSWGRKGC----VSSAFFVSVPYFREWILN 245
                  |.| .||||:|.:.|    |.|. :..|..|..|||:
Mosquito   200 LDRFGRNVQ-HGVVSYGVQDCSLENVPSV-YTRVESFINWILH 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 63/234 (27%)
Tryp_SPc 27..243 CDD:238113 63/234 (27%)
AgaP_AGAP009216XP_001238238.1 Tryp_SPc 14..238 CDD:214473 63/234 (27%)
Tryp_SPc 14..238 CDD:238113 63/234 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.