DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP010015

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_001238092.2 Gene:AgaP_AGAP010015 / 4577984 VectorBaseID:AGAP010015 Length:239 Species:Anopheles gambiae


Alignment Length:243 Identity:60/243 - (24%)
Similarity:104/243 - (42%) Gaps:39/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCF----FDEEGNRLDDQGYQVRA 86
            ||:.|..:..|:.|:.|::.:....:|.|:|.:.:.:::..:||    |.          ..:..
Mosquito     9 RILNGLKVNPERYPFIVNIYFEDQFLCSGNIITPSHVLSLEYCFEIFVFQ----------MSIYG 63

  Fly    87 GSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPL---EFTSKVQPIPLAKTNPYPRSI 148
            |.....|.|..:.|..:.||..:.:....:|..:..:|.|:   :..:.:..|.|..:...|.|.
Mosquito    64 GGTSPLSGGISIPVNKITIHPNFEYRYGRSDFDVAVISVPINTFQGMANMASIALQTSEVLPGSR 128

  Fly   149 ALVSGWGVSYILNDSTNLYPTHLQGL---ALHIKSIFSC--------RLFDPSLLCAG-TYGRTA 201
            ..|.|||||.|..      |..|.||   .::|.|..:|        .....:::||. .:|...
Mosquito   129 CYVIGWGVSKIFG------PIDLNGLHYGTMNIVSQSACSRSWASVNENVTSNMICAKYCFGVDI 187

  Fly   202 CHGDSGGPLVVNKQLVGVVSWGRKGCVSS--AFF--VSVPYFREWILN 245
            |:||.|||||.:.:|.|::.:...||..:  |.|  :..|..|.:|.|
Mosquito   188 CYGDLGGPLVCDGKLTGIIGYTEYGCTKNNPAVFTRIMAPSIRSFIRN 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 58/239 (24%)
Tryp_SPc 27..243 CDD:238113 57/238 (24%)
AgaP_AGAP010015XP_001238092.2 Tryp_SPc 9..224 CDD:214473 56/230 (24%)
Tryp_SPc 10..235 CDD:238113 58/240 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.