DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP010614

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_001237580.2 Gene:AgaP_AGAP010614 / 4577723 VectorBaseID:AGAP010614 Length:266 Species:Anopheles gambiae


Alignment Length:235 Identity:70/235 - (29%)
Similarity:107/235 - (45%) Gaps:27/235 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSAL 90
            ||:.|:.:.|.:..:.:||:..|...||.:|.:.:..:|||||.:....   |.....:..||..
Mosquito    36 RIVNGKAVSIVKYKYALSLRVNGVFDCGATIITNSHSLTAAHCVYKYPS---DPSRVTLYGGSTS 97

  Fly    91 TDSNGTLVDVAALIIHEEY---AFDLNINDIAIVRLSTPL-EFTSKVQPIPLA-KTNPYP-RSIA 149
            |.|.|..|.|.::.:|..|   ||.. .:|..:..|:.|: .|:.:....||| :||..| .:..
Mosquito    98 TSSGGIEVPVVSIALHPNYNRKAFPA-ASDCDVAVLNVPVNSFSGRPNMAPLALQTNELPVGTEC 161

  Fly   150 LVSGWGVSYILNDSTNLYPTHLQGLA---LHIKSIFSCRLF---DPSLLCAG-TYGRTACHGDSG 207
            .|.|||      .:.|..|..:..|.   ::|.|..:|...   ..:::||. ..|...|.||||
Mosquito   162 FVIGWG------RTGNNQPASVNQLRYANMNIVSQSTCATMWAEYRNMICAKYNNGVDTCGGDSG 220

  Fly   208 GPLVVNKQLVGVVSWGRKGCVSS--AFF--VSVPYFREWI 243
            |.||....|.||||:....|.|:  |.|  ::.|..|.:|
Mosquito   221 GALVCGSGLAGVVSFSHPNCTSAWPAGFAKITAPSIRSFI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 69/233 (30%)
Tryp_SPc 27..243 CDD:238113 68/232 (29%)
AgaP_AGAP010614XP_001237580.2 Tryp_SPc 36..253 CDD:214473 67/226 (30%)
Tryp_SPc 37..262 CDD:238113 69/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.