DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP012566

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_001230550.2 Gene:AgaP_AGAP012566 / 4397709 VectorBaseID:AGAP012566 Length:282 Species:Anopheles gambiae


Alignment Length:210 Identity:56/210 - (26%)
Similarity:85/210 - (40%) Gaps:26/210 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGN--RLDDQGYQVRAGS 88
            ||..|..:.|.:..:.:.|:..|...|...:.|.:..:|.|...:....|  ||...|     ||
Mosquito    50 RIFNGVAVDIARYRFAIILRLDGQIRCSAVVISLSHALTGADAVYPYRNNIQRLTLYG-----GS 109

  Fly    89 ALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPL-EFTSK--VQPIPLAKTNPYPRSIAL 150
            ....|.|....:..:.:|..:..:..::|..|..|:.|. .|..|  :.||.||.......:...
Mosquito   110 TSPTSGGFSFQLTRIAVHPNFNPNSGVSDFNIAVLTVPTNSFGGKRNIAPISLASAGVAIGTKCS 174

  Fly   151 VSGWGVSYILNDSTNLY-PTH-LQGLALHIKSIFSC-RLF-------DPSLLCA-GTYGRTACHG 204
            |.|||     ..|.||. |.: |:...:.|.|..:| ||:       ..:::|| |..|...|.|
Mosquito   175 VFGWG-----KTSVNLSGPANTLRSADMIITSEATCARLWAQFGVKITSNMVCAKGDRGADLCTG 234

  Fly   205 DSGGPLVVNKQLVGV 219
            |.|..||.:.:|.||
Mosquito   235 DYGNALVCSGRLTGV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 56/210 (27%)
Tryp_SPc 27..243 CDD:238113 55/209 (26%)
AgaP_AGAP012566XP_001230550.2 Tryp_SPc 50..276 CDD:214473 56/210 (27%)
Tryp_SPc 51..279 CDD:304450 55/209 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.