DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG34130

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:272 Identity:60/272 - (22%)
Similarity:115/272 - (42%) Gaps:36/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ESFLLLLALDFLSAGQVNRWEQR---IIGGEPI------GIEQ------VPWQVSLQYFGDHVCG 53
            |.|.:.|.|..:.|...:.|...   :.|..|:      ||.:      |||.:.:......|||
  Fly     6 EIFSIALLLTEVGAAHSSWWNSSASYLHGRPPVRTLNKNGIRRTSGGHAVPWLLRIVDGPTFVCG 70

  Fly    54 GSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVD-----VAALIIHEEYAFDL 113
            .|..|....:|:|:|..... ::::....::.:..:..|:.....|     :..:|:.:::.:..
  Fly    71 ASYLSALYALTSANCMHSHR-SQMESLSVELVSSDSRQDNQLDSHDPPNALIRNIIVSKDWHWPG 134

  Fly   114 NINDIAIVRLSTPLEFTSKVQPIPLAKTNPYP--RSIALVSGWGVSYILNDSTNLYPTHLQGLAL 176
            ...|:|::.|:..|. .::...:.|. |||..  :|:::     |||....:.|:....::.|..
  Fly   135 TFMDVAVIELTNRLR-GNRNNYVTLC-TNPLSSYKSLSV-----VSYGAGPAENVRTEEIEVLNR 192

  Fly   177 HI-KSIFSCRLFDPSLLCAGTYGRTA-CHGDSGGPLVVNKQLVGVVSWGRKGCVSS---AFFVSV 236
            .| .|.:...|...::.||..:.|:| |...:|.|:....||.|:|:|. ..|..|   ..|..:
  Fly   193 MICDSAYGNFLLRETVACAKEFKRSADCMFSAGCPVTAGDQLCGIVAWS-PACKRSNLPGIFTDI 256

  Fly   237 PYFREWILNAIA 248
            ...:.:||.||:
  Fly   257 HQVKRFILKAIS 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 50/243 (21%)
Tryp_SPc 27..243 CDD:238113 50/239 (21%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 46/218 (21%)
Tryp_SPc 53..256 CDD:304450 46/211 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.