DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Gm5771

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001034086.1 Gene:Gm5771 / 436523 MGIID:3646222 Length:245 Species:Mus musculus


Alignment Length:260 Identity:82/260 - (31%)
Similarity:129/260 - (49%) Gaps:32/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SFLLLLALDFLSAGQVNRW---EQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAA 66
            |.||.|||    .|....:   :.:|:||.......||:||||. .|.|.||||:.::..:|:||
Mouse     2 SALLFLAL----VGAAVAFPVDDDKIVGGYTCRENSVPYQVSLN-SGYHFCGGSLINDQWVVSAA 61

  Fly    67 HCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTS 131
            ||:......||.:...:|..|      |...|:.|.:|.|..:......|||.:::||:|:...:
Mouse    62 HCYKTRIQVRLGEHNIKVLEG------NEQFVNAAKIIKHPNFNRKTLNNDIMLIKLSSPVTLNA 120

  Fly   132 KVQPIPLAKTNPYPRSIALVSGWG--VSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDP----- 189
            :|..:.|..:.....:..|:||||  :|:.:::     |..||.|...:.....|....|     
Mouse   121 RVATVALPSSCAPAGTQCLISGWGNTLSFGVSE-----PDLLQCLDAPLLPQADCEASYPGKITG 180

  Fly   190 SLLCAGTY--GRTACHGDSGGPLVVNKQLVGVVSWGRKGCV---SSAFFVSVPYFREWILNAIAS 249
            :::|||..  |:.:|.||||||:|.|.:|.|:|||| .||.   :...:..|..:.:||.:.||:
Mouse   181 NMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWG-YGCALADNPGVYTKVCNYVDWIQDTIAA 244

  Fly   250  249
            Mouse   245  244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 71/228 (31%)
Tryp_SPc 27..243 CDD:238113 71/227 (31%)
Gm5771NP_001034086.1 Tryp_SPc 22..238 CDD:214473 71/228 (31%)
Tryp_SPc 23..241 CDD:238113 73/230 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.