DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001025468.1 Gene:Tmprss11c / 435845 MGIID:3521861 Length:431 Species:Mus musculus


Alignment Length:236 Identity:79/236 - (33%)
Similarity:118/236 - (50%) Gaps:27/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSAL 90
            ::.||:.....:.|||.|||....|.||.::.|...::||||||.    ...:.:.::|..|..|
Mouse   199 KVAGGQDAEEGEWPWQASLQQNSVHRCGATLISNYWLITAAHCFI----RAANPKDWKVSFGFLL 259

  Fly    91 TDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQP--IPLAKTNPYPRSIALVSG 153
            :....... |..:||||.|::..:.||||:||||:|:.:.|.::.  :|.|.....|.|..:|:|
Mouse   260 SKPQAPRA-VKNIIIHENYSYPAHDNDIAVVRLSSPVLYESNIRRACLPEATQKFPPNSDVVVTG 323

  Fly   154 WGVSYILNDSTNLYPTHLQGLALHIKSIFSCR-------LFDPSLLCAG-TYGRT-ACHGDSGGP 209
            ||......||.|:    ||...:.|....:|.       :..|.::||| ..||. ||.||||||
Mouse   324 WGTLKSDGDSPNI----LQKGKVKIIDNKTCNSGKAYGGMITPGMMCAGFLKGRVDACQGDSGGP 384

  Fly   210 LVVNKQ-----LVGVVSWGRKGCVSS--AFFVSVPYFREWI 243
            ||....     |.|:||||.:..:.:  ..:..|.|:|:||
Mouse   385 LVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTYYRDWI 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 77/234 (33%)
Tryp_SPc 27..243 CDD:238113 77/233 (33%)
Tmprss11cNP_001025468.1 SEA 62..157 CDD:279699
Tryp_SPc 199..425 CDD:214473 77/234 (33%)
Tryp_SPc 200..428 CDD:238113 79/235 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.