DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Jon99Ci

DIOPT Version :10

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:33 Identity:8/33 - (24%)
Similarity:13/33 - (39%) Gaps:6/33 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PQENKSKPSKQSTVGKTVTVRLPRSPQSEKVFD 64
            |...:.||:|...     .:..|: |..:..||
  Fly   481 PDHTRLKPAKDCK-----PIEYPK-PDGKLTFD 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 27..243 CDD:238113 8/33 (24%)
Jon99CiNP_524555.1 Tryp_SPc 41..266 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.