DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:296 Identity:80/296 - (27%)
Similarity:118/296 - (39%) Gaps:94/296 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSA--------------------GQVNRWEQRIIGGEPIGIEQVPW--QVSLQYFGD 49
            |.||:|.||..                    |.:   |.||..|......|||:  .|||...|:
  Fly     4 LTLLSLAFLGVCSALTVPHSLVHPRDLEIRHGGI---EGRITNGNLASEGQVPYIVGVSLNSNGN 65

  Fly    50 -HVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAAL----IIHEEY 109
             ..|||||.....::|||||                .||:          |.|:|    :.:.|.
  Fly    66 WWWCGGSIIGHTWVLTAAHC----------------TAGA----------DEASLYYGAVNYNEP 104

  Fly   110 AFDLNI---------------NDIAIVRLSTP-LEFTSKVQPIPLA----KTNPYPRSIALVSGW 154
            ||...:               :|:|:::  || ::|.|.|..|.|.    :.|.|..:....:||
  Fly   105 AFRHTVSSENFIRYPHYVGLDHDLALIK--TPHVDFYSLVNKIELPSLDDRYNSYENNWVQAAGW 167

  Fly   155 GVSYILNDSTNLYPTHLQGLALHIKSIFSCRLF------DPSLLCAGT-YGRTACHGDSGGPLVV 212
            |..|   |.:|:. ..|:.:.|.:.|:..|:.:      ..:.:|..| .|:..|.||||||||.
  Fly   168 GAIY---DGSNVV-EDLRVVDLKVISVAECQAYYGTDTASENTICVETPDGKATCQGDSGGPLVT 228

  Fly   213 NK--QLVGVVSW-GRKGCV--SSAFFVSVPYFREWI 243
            .:  :|:|:.|: ...||.  ..|.|..|..:.|||
  Fly   229 KEGDKLIGITSFVSAYGCQVGGPAGFTRVTKYLEWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 70/255 (27%)
Tryp_SPc 27..243 CDD:238113 69/254 (27%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 70/255 (27%)
Tryp_SPc 41..266 CDD:238113 71/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.