DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and intr

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:258 Identity:57/258 - (22%)
Similarity:98/258 - (37%) Gaps:69/258 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GG--EPIGIEQVPWQVS----------------------LQYFGDHVCGGSIYSENIIVTAAHCF 69
            ||  ||..:|.:|.::.                      :.|....:|.|::.|..:::|:|.| 
  Fly    66 GGNKEPNSLEIIPAEIETLLTDGQATTEAPKAVKHFVMRILYENKVICSGALISTRLVLTSALC- 129

  Fly    70 FDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQ 134
            |.....:...:.|:::|      |...:..||.||...       |.|:|::.|..||| ...|.
  Fly   130 FPRTLRQPPPRSYKLQA------SRSRIYSVANLITGA-------IEDMALLLLHAPLE-DPFVH 180

  Fly   135 PIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPT--HLQGLALHIKSIFSCR---------LFD 188
            ||.|.: :|..|              ||:..:|.:  ||:.|...:....:|:         ...
  Fly   181 PIDLCE-SPLRR--------------NDNVTMYMSQQHLRFLRTKLIPNSNCKRSYAQDENAFIT 230

  Fly   189 PSLLCAGTYGRTA-CHGDSGGPLVVNKQLVGVVSWGR---KGCVSSAFFVSVPYFREWILNAI 247
            .::|||....|.. |....|..|:...:|.||..:|:   .|.|:...:..|...|..:::.|
  Fly   231 QTMLCALNSNRLVDCQTAKGDVLLHQDRLCGVDIYGQHCSDGGVNGELYADVFKARTELMHLI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 56/252 (22%)
Tryp_SPc 27..243 CDD:238113 56/252 (22%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 48/201 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.