DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG5909

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_651544.1 Gene:CG5909 / 43274 FlyBaseID:FBgn0039495 Length:381 Species:Drosophila melanogaster


Alignment Length:265 Identity:69/265 - (26%)
Similarity:106/265 - (40%) Gaps:54/265 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NRWEQRIIGGEPIGIEQVPWQVSLQY-FGD---HVCGGSIYSENIIVTAAHCFFDEEGNRLDDQG 81
            |:...::.||:.......||...|:| ..|   ..||||:.||..|:|||||..|:      .:.
  Fly   124 NKGNPKVSGGKTARPGDFPWVALLKYKINDPRPFRCGGSLISERHILTAAHCIIDQ------PEV 182

  Fly    82 YQVRAGSALTDS-------NGT---------LVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFT 130
            ..||.|....:|       .||         ...:..:.:|..|......:|:||::|...::..
  Fly   183 IAVRLGEHDLESEEDCHYLGGTNRVCIPPYEEYGIEQIRVHPNYVHGKISHDVAIIKLDRVVKEK 247

  Fly   131 SKVQPIPL-----AKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLF--- 187
            |.::|:.|     ::...:.:|. .|:|||     ........|.||...:..||:..||.:   
  Fly   248 SHIKPVCLPIDQKSQELDFDQSF-FVAGWG-----GTEKETVATKLQQALITRKSLNECRQYYNK 306

  Fly   188 ----DPSLLCAGTYGRTACHGDSGGPLVVNKQL--------VGVVSWGRKGCVSS--AFFVSVPY 238
                |..:...||..:..|.||||||:....:.        .||||:|.:.|..:  ..|.||..
  Fly   307 GEVSDNHICATGTGIKHTCQGDSGGPVFFKHRFKNTYRVVQYGVVSFGGRLCGQNQPGVFASVID 371

  Fly   239 FREWI 243
            ...||
  Fly   372 MLPWI 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 66/258 (26%)
Tryp_SPc 27..243 CDD:238113 66/257 (26%)
CG5909NP_651544.1 CLIP 25..82 CDD:197829
Tryp_SPc 129..376 CDD:214473 66/258 (26%)
Tryp_SPc 132..379 CDD:238113 68/257 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.