DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG34129

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster


Alignment Length:244 Identity:57/244 - (23%)
Similarity:100/244 - (40%) Gaps:46/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 WEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAG 87
            |..||:.|:                |:..||.:.|:..:::|:|:|.:... |.|  :|..|. |
  Fly    55 WLLRILNGD----------------GNFACGAAYYAPLLVITSANCIYPYR-NSL--EGATVE-G 99

  Fly    88 SALTD-SNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPL-----EFTSKVQPIPLAKTNPYPR 146
            :|.:: ......|:..:...|::.:.....|:|:|||..|:     ||      |.|......|:
  Fly   100 TAFSECDRENYADIDTIQFPEKFIYQKLYMDVAVVRLRDPVRGRLTEF------IRLCSVKVQPK 158

  Fly   147 SIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCR--LFDPSLLCAGTYGR-----TACHG 204
            ...:|.|||..   |....:..:..:.:.:.|.||..||  ...|.:.......|     ..|..
  Fly   159 MQMVVFGWGFD---NTEVEIPSSDPRNVTVTIISIKECRQKFKSPKIASTSICARQPKNPKQCLY 220

  Fly   205 DSGGPLVVNKQLVGVVSWGRKGCVSSA---FFVSVPYFREWILNAIASI 250
            |.|.||:..::|.||||:| ..|:.::   .:.::...:.:|.....||
  Fly   221 DGGSPLIYGRELCGVVSFG-SHCIDTSRPGMYTNIRRVKRFITETEESI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 53/232 (23%)
Tryp_SPc 27..243 CDD:238113 52/231 (23%)
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 54/235 (23%)
Tryp_SPc 55..261 CDD:304450 54/235 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.