DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG31266

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:231 Identity:66/231 - (28%)
Similarity:102/231 - (44%) Gaps:22/231 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQ-YFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSA 89
            |:|||........||..|:| .:..|:||..|..|..::|||.|...     |......|..|:.
  Fly    51 RVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAG-----LRPLNLLVVTGTV 110

  Fly    90 -LTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALV-S 152
             ..|.......|:.:.:|..:...|..||||:::||:.:||....:.|.||..:.......|. :
  Fly   111 DWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFA 175

  Fly   153 GWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRL-------FDPSLLCAG-TYGRTACHGDSGGP 209
            |||.|    ::...|..:||..:.....:.:||.       .|...:|.. ..|:.|||||:|||
  Fly   176 GWGSS----EAMGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQGACHGDTGGP 236

  Fly   210 LVVNKQ-LVGVVSWGRK-GCVSSAFFVSVPYFREWI 243
            |:..:| |||:.:||.. |......:....::.:||
  Fly   237 LIDEQQRLVGIGNWGVPCGRGYPDVYARTAFYHDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 64/229 (28%)
Tryp_SPc 27..243 CDD:238113 63/228 (28%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 64/229 (28%)
Tryp_SPc 52..275 CDD:238113 65/230 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.