DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and ea

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:280 Identity:84/280 - (30%)
Similarity:127/280 - (45%) Gaps:60/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 NRWEQRIIGGEPIGIEQVPWQVSLQYFGD-----HVCGGSIYSENIIVTAAHCFFDEEGNRL--D 78
            |....||.||....|::.||...::|...     |.||||:.|...::||:||.   .|..|  |
  Fly   122 NILSNRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCV---NGKALPTD 183

  Fly    79 DQGYQVRAGSALTDSNGTL-VDVAAL---------------IIHEEY--AFDLNINDIAIVRLST 125
            .:...||.|...|::|... |||..:               |.|.:|  |....:||||::||:.
  Fly   184 WRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQ 248

  Fly   126 PLEFTSKVQPIPLAKTNPYPRSIAL-----------VSGWGVSYILNDSTNLYPTHLQGLAL-HI 178
            .:|:|..|:||.|      |..:.|           |:|||.:..|:.|.......::|..: ..
  Fly   249 QVEYTDFVRPICL------PLDVNLRSATFDGITMDVAGWGKTEQLSASNLKLKAAVEGFRMDEC 307

  Fly   179 KSIFSCR--LFDPSLLCA-GTYGRTACHGDSGGPLV---VNKQ-----LVGVVSWGRKGCVSSAF 232
            ::::|.:  |.:.:.:|| |..|..:|.|||||||:   .||.     |.||||:|...|..:.:
  Fly   308 QNVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGLAGW 372

  Fly   233 ---FVSVPYFREWILNAIAS 249
               :..|..:.:||.|.|.|
  Fly   373 PGVYTLVGKYVDWIQNTIES 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 78/267 (29%)
Tryp_SPc 27..243 CDD:238113 77/266 (29%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 78/267 (29%)
Tryp_SPc 128..389 CDD:238113 79/269 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.