DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG3505

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:276 Identity:76/276 - (27%)
Similarity:116/276 - (42%) Gaps:64/276 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GQVNRWEQRIIGGEPIGIEQVPWQVSLQYF-GD----HVCGGSIYSENIIVTAAHCFFDEEGNRL 77
            |:| ||::.  ......|.:.||...::|. |:    |.|||.:.|:..::|||||......:.|
  Fly   101 GKV-RWQRS--NDTDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATSNL 162

  Fly    78 DDQGYQVRAG---------------SALTDSNGTLVDVA--ALIIHEEY--AFDLNINDIAIVRL 123
              |...||.|               |.:.|......|:|  .|:.|..|  .....|||||:|||
  Fly   163 --QITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRL 225

  Fly   124 STPLEFTSKVQPIPL----AKTNPYPRSIALVSGWGVSYILNDSTNL---YPTHLQGLALHIKSI 181
            ::|.:....||||.|    .:.:.....:..|:||..|    .|..:   |.|        |.||
  Fly   226 ASPAKLNDFVQPICLPNKQLRADELEDLVTEVAGWQAS----SSQRMRKGYVT--------ISSI 278

  Fly   182 FSCR--------LFDPSLLCAGTYGRTACHGDSGGPLVVNKQ----LVGVVSWGRKGCVSSAF-- 232
            ..|:        ....|.|| |......|:|::||||::.|.    |.|:||:|...|.:..:  
  Fly   279 EECQRKYASQQLRIQASKLC-GLTNSQECYGNAGGPLMLFKNDGYLLGGLVSFGPVPCPNPDWPD 342

  Fly   233 -FVSVPYFREWILNAI 247
             :..|..:.:||.:::
  Fly   343 VYTRVASYIDWIHDSL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 70/262 (27%)
Tryp_SPc 27..243 CDD:238113 70/261 (27%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 72/259 (28%)
Tryp_SPc 111..354 CDD:214473 70/257 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.