DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Try10

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001004097.1 Gene:Try10 / 408247 RGDID:1359400 Length:246 Species:Rattus norvegicus


Alignment Length:255 Identity:82/255 - (32%)
Similarity:128/255 - (50%) Gaps:25/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFD 71
            :|:|||...:.......:.:|:||.......||:||||. .|.|.||||:.:|..:|:||||:..
  Rat     4 VLILALVGAAVAFPAADDDKIVGGYTCQENSVPYQVSLN-SGYHFCGGSLINEQWVVSAAHCYKS 67

  Fly    72 EEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPI 136
            ....||.:....|..|      |...|:.|.:|.|..:......|||.:::||:|::..|:|..:
  Rat    68 RIQVRLGEHNINVLEG------NEQFVNAAKIIKHPNFIRKTLNNDIMLIKLSSPVKLNSRVATV 126

  Fly   137 PLAKTNPYPRSIALVSGWG--VSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDP-----SLLCA 194
            .|..:.....:..|:||||  :|:.:|:     |..||.|...:.....|....|     :::||
  Rat   127 ALPSSCAPAGTQCLISGWGNTLSFGVNE-----PDLLQCLDAPLLPQADCEASYPGKITDNMVCA 186

  Fly   195 GTY--GRTACHGDSGGPLVVNKQLVGVVSWGRKGCV---SSAFFVSVPYFREWILNAIAS 249
            |..  |:.:|.||||||:|.|.:|.|:|||| .||.   :...:..|..:.:||.:.||:
  Rat   187 GFLEGGKDSCQGDSGGPVVCNGELQGIVSWG-YGCALPDNPGVYTKVCNYVDWIQDTIAA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 74/228 (32%)
Tryp_SPc 27..243 CDD:238113 74/227 (33%)
Try10NP_001004097.1 Tryp_SPc 23..239 CDD:214473 74/228 (32%)
Tryp_SPc 24..242 CDD:238113 76/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.