DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Klk1c6

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_038942515.1 Gene:Klk1c6 / 408242 RGDID:1303220 Length:262 Species:Rattus norvegicus


Alignment Length:273 Identity:77/273 - (28%)
Similarity:116/273 - (42%) Gaps:49/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIESFLLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTA 65
            |:::...|:|::..:.|....  :.|::||........||||::  ....:|||.:...:.::||
  Rat     1 MWLQILFLVLSMGRIDAAPPG--QSRVVGGYKCEKNSQPWQVAV--ISRSLCGGVLIDPSWVITA 61

  Fly    66 AHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVD--------VAALIIHEEY-----------AF 111
            |||:    .|.|  ..|.|..|     .|....|        |:....|.:|           ..
  Rat    62 AHCY----SNAL--SYYHVLLG-----RNNLSEDEPFAQYRFVSQSFPHPDYNPFFMRNHTRQPG 115

  Fly   112 DLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLAL 176
            |...||:.::.||.|.:.|..|:.|.|....|...|..|.||||.:..|:..   .|..||.:.:
  Rat   116 DDYSNDLMLLHLSKPADITDGVKVIDLPTEEPKVGSTCLASGWGSTKPLDWE---LPDDLQCVNI 177

  Fly   177 HIKSIFSC------RLFDPSLLCAGTY--GRTACHGDSGGPLVVNKQLVGVVSWGRKGCVS---S 230
            |:.|...|      ::.| .:||||..  |:..|.|||||||:.:..|.|:.|||...|..   .
  Rat   178 HLLSNEKCIEAYNEKVTD-LMLCAGDLEGGKDTCKGDSGGPLICDGVLQGITSWGSDPCAEPNMP 241

  Fly   231 AFFVSVPYFREWI 243
            |.:..:..|..||
  Rat   242 AIYTKLIKFTSWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 71/246 (29%)
Tryp_SPc 27..243 CDD:238113 70/245 (29%)
Klk1c6XP_038942515.1 Tryp_SPc 25..257 CDD:238113 72/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.