DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG11037

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:261 Identity:83/261 - (31%)
Similarity:128/261 - (49%) Gaps:34/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LALDFLSAGQV---NRWEQRIIGGE-----PIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAA 66
            |.||.....::   :..|.|:|||.     .:|    .:..:|.|..|.||||::.:|||::|||
  Fly    42 LTLDVAQLAKIVLPSPHETRVIGGHVTTNAKLG----GYLTALLYEDDFVCGGTLLNENIVLTAA 102

  Fly    67 HCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTS 131
            |||.    .|:....:.|.||.:..:..|....|...|:.|::..|....|:|:|.|.|||: ..
  Fly   103 HCFL----GRMKASEWIVAAGISNLNQKGIRRHVKDFILSEQFREDDMNMDVAVVLLKTPLK-AK 162

  Fly   132 KVQPIPLAKTNPYPRSIALVSGWGVSYILNDST-NLYPTHLQGLALHIKSIFSCR-LFDP----- 189
            .:..:.|...:..|....:|||||::....... ||..|....: :|.|   :|| .:.|     
  Fly   163 NIGTLSLCSVSLKPGVELVVSGWGMTAPRGRGPHNLLRTVTVPI-IHKK---NCRAAYQPTAKIT 223

  Fly   190 -SLLCAGTYGR-TACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWILNAIAS 249
             |::||...|| .||..|||||||..||:.|:||:| .||.|:.:   :..|.|.:.:|..:|.:
  Fly   224 DSMICAAVLGRKDACTFDSGGPLVFKKQVCGIVSFG-IGCASNRYPGVYTDVMYVKPFIEKSIKA 287

  Fly   250 I 250
            :
  Fly   288 L 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 77/233 (33%)
Tryp_SPc 27..243 CDD:238113 76/232 (33%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 77/233 (33%)
Tryp_SPc 62..283 CDD:238113 77/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.