DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG7542

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:256 Identity:76/256 - (29%)
Similarity:120/256 - (46%) Gaps:47/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQRIIGGEPIGIEQVPWQVSLQY-FGDHV--CGGSIYSENIIVTAAHCFFDEE-----------G 74
            |..|..|||..:.|.|:|..|.. ||:..  |||::.|...|:|||||....|           |
  Fly    24 EPYITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWIITAAHCMDGAESVTVYLGAINIG 88

  Fly    75 NRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQ--PIP 137
            :..::...::            :|:.:.:|:|..|.....:|||:::||...:.||.:::  .:|
  Fly    89 DESEEGQERI------------MVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLP 141

  Fly   138 LAKTNPYP--RSI-ALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLF-----DPSLLC- 193
            ......:|  .|| |..||||.....:||.:  |. |:.:.:.|.....||::     ...::| 
  Fly   142 RRLNGQFPTYESIRAFASGWGRESDASDSVS--PV-LRYVEMPIMPHSLCRMYWSGAVSEKMICM 203

  Fly   194 AGTYGRTACHGDSGGPLVV----NKQLVGVVSWGRK-GCVSS--AFFVSVPYFREWILNAI 247
            :.|.|::.||||||||||.    :..|:|..|:|.. ||...  |.|..:..:.:||||.|
  Fly   204 STTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWILNHI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 70/248 (28%)
Tryp_SPc 27..243 CDD:238113 70/247 (28%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 73/250 (29%)
Tryp_SPc 27..260 CDD:214473 70/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.