DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG4998

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001036609.1 Gene:CG4998 / 39808 FlyBaseID:FBgn0036612 Length:1185 Species:Drosophila melanogaster


Alignment Length:249 Identity:73/249 - (29%)
Similarity:108/249 - (43%) Gaps:44/249 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QVPWQVSL----QYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTL 97
            :.||.|::    .....:.|||::.....|::||||...:.|..|     :||.|.  .|.|..:
  Fly   947 EYPWHVAILKKDPKESIYACGGTLIDAQHIISAAHCIKSQNGFDL-----RVRLGE--WDVNHDV 1004

  Fly    98 V-------DVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSK--VQPIPLA-KTNPYPRSIALVS 152
            .       ||.::.||.||......||:|:::|..|::||..  :.|..|. |.:.:..:....:
  Fly  1005 EFFPYIERDVVSVHIHPEYYAGTLDNDLAVLKLDQPVDFTKNPHISPACLPDKYSDFTGARCWTT 1069

  Fly   153 GWGVSYILNDSTNLYPTHLQGLALHIKSIFSC-------RL-----FDPSLLCA-GTYGRTACHG 204
            |||....  .....|...|:.:.:.|.|...|       ||     .:|..:|| |..|:.||.|
  Fly  1070 GWGKDAF--GEHGKYQNILKEVDVPILSHQQCESQLRNTRLGYSYKLNPGFVCAGGEEGKDACKG 1132

  Fly   205 DSGGPLVVNK----QLVGVVSWGRKGCVS---SAFFVSVPYFREWILNAIASIQ 251
            |.|||||.::    .:||||||| .||..   ...:|.|..:..||.....|.|
  Fly  1133 DGGGPLVCDRNGAMHVVGVVSWG-IGCGQVNVPGVYVKVSAYLPWIQQITQSYQ 1185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 69/239 (29%)
Tryp_SPc 27..243 CDD:238113 69/239 (29%)
CG4998NP_001036609.1 Tryp_SPc 942..1180 CDD:238113 71/242 (29%)
Tryp_SPc 942..1177 CDD:214473 69/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.