DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and cfd

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_989320.1 Gene:cfd / 394945 XenbaseID:XB-GENE-973605 Length:265 Species:Xenopus tropicalis


Alignment Length:267 Identity:71/267 - (26%)
Similarity:119/267 - (44%) Gaps:36/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFD 71
            ||.:.|....|....|...||:||:....|..|:..|:|..|.|.|||.:.::..:::||||..:
 Frog     7 LLAVVLVLTVATYECRPRGRILGGQDSKAEVRPYMASIQQNGIHQCGGVLIADKWVLSAAHCATN 71

  Fly    72 EEGNRLDDQGYQVRAGS---ALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKV 133
            ...:.|:     |..|:   :..:....:|.|...|.|..|...:..:|:.::.||..:..:..|
 Frog    72 SSNSSLN-----VMLGAISLSKPEKYKIVVKVLREIPHPLYNSTIKHHDLLLLELSEKVTLSPAV 131

  Fly   134 QPIPLAKTNPYPRSI-------ALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSC---RLFD 188
            .|:|....|     |       .||:|||...:    |...|..||.|.:.:.|...|   ..:|
 Frog   132 NPLPFQNEN-----IDISAGKRCLVAGWGQMRL----TGKKPDTLQELWVPLISRDVCNRRNYYD 187

  Fly   189 ----PSLLCAGTYGRTACHGDSGGPLVVNKQLVGVVSWGRKGC---VSSAFFVSVPYFREWILNA 246
                .:::|||...:.:|.||||||||.:...|.:|..|.:.|   .....:..:..::.||:.:
 Frog   188 NEITANMICAGESRKDSCEGDSGGPLVCDGIAVAIVQGGFRKCGNPTKPGIYTLIEPYKSWIMES 252

  Fly   247 I--ASIQ 251
            :  |::|
 Frog   253 MYNATLQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 62/236 (26%)
Tryp_SPc 27..243 CDD:238113 61/235 (26%)
cfdNP_989320.1 Tryp_SPc 27..251 CDD:238113 63/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.